import gradio as gr import pandas as pd import numpy as np import torch import torch.nn as nn import torch.nn.functional as F import xgboost as xgb from transformers import AutoTokenizer, AutoModel, AutoConfig, EsmModel, EsmTokenizer import plotly.graph_objects as go from pathlib import Path import json import time from typing import List, Dict, Any, Tuple, Optional import subprocess from collections import defaultdict from huggingface_hub import snapshot_download from pathlib import Path import os from inference import ( PeptiVersePredictor, read_best_manifest_csv, BestRow, ) try: from Bio.SeqUtils.ProtParam import ProteinAnalysis BIOPYTHON_AVAILABLE = True except ImportError: BIOPYTHON_AVAILABLE = False print("BioPython not available. Using fallback for pI/charge calculations.") def pick_assets_root() -> Path: # HF Spaces container uses /home/user; detect via SPACE_ID or existence spaces_root = Path("/home/user/assets") if os.environ.get("SPACE_ID") or spaces_root.parent.exists(): try: spaces_root.mkdir(parents=True, exist_ok=True) return spaces_root except Exception: pass # fall through to local options # Allow manual override env = os.environ.get("HF_ASSETS_DIR") if env: p = Path(env); p.mkdir(parents=True, exist_ok=True) return p # Local fallbacks for p in [Path.home() / "assets", Path.cwd() / "assets", Path("/tmp/assets")]: try: p.mkdir(parents=True, exist_ok=True) return p except Exception: continue raise RuntimeError("No writable assets directory found.") ASSETS = pick_assets_root() # Put all caches on the same writable disk for k, v in { "HF_HOME": str(ASSETS / "hf"), "HUGGINGFACE_HUB_CACHE": str(ASSETS / "hf" / "cache"), "TRANSFORMERS_CACHE": str(ASSETS / "transformers"), "HF_DATASETS_CACHE": str(ASSETS / "hf" / "datasets"), "XDG_CACHE_HOME": str(ASSETS / "xdg"), "TMPDIR": str(ASSETS / "tmp"), }.items(): os.environ.setdefault(k, v) Path(v).mkdir(parents=True, exist_ok=True) ASSETS_MODELS = ASSETS / "models"; ASSETS_MODELS.mkdir(parents=True, exist_ok=True) ASSETS_DATA = ASSETS / "training_data_cleaned"; ASSETS_DATA.mkdir(parents=True, exist_ok=True) MODEL_REPO = "ChatterjeeLab/PeptiVerse" # model repo DATASET_REPO = "ChatterjeeLab/PeptiVerse" # dataset repo BEST_TXT = Path("basic_models.txt") TRAINING_ROOT = ASSETS_MODELS / "training_classifiers" #TOKENIZER_DIR = ASSETS_MODELS / "tokenizer" # Banned models that should fall back to XGB BANNED_MODELS = {"svm", "enet", "svm_gpu", "enet_gpu"} # "lower is better" exceptions for classification labeling LOWER_BETTER = {"hemolysis", "toxicity"} def canon_model(parsed) -> Optional[str]: """Return the bare lowercase model name from a parsed (model, emb_tag) tuple or raw string.""" if parsed is None: return None if isinstance(parsed, tuple): return parsed[0].lower() if parsed[0] else None return str(parsed).lower() def get_required_patterns(manifest_path: Path) -> List[str]: """Build allow_patterns from the manifest so we only download what we need.""" from inference import read_best_manifest_csv, EMB_TAG_TO_FOLDER_SUFFIX manifest = read_best_manifest_csv(manifest_path) patterns = set() patterns.add("training_data_cleaned/**/*.csv") for prop_key, row in manifest.items(): disk_prop = "half_life" if prop_key == "halflife" else prop_key for parsed in [row.best_wt, row.best_smiles]: if parsed is None: continue model_name, emb_tag = parsed if prop_key == "binding_affinity": folder = model_name # e.g. "wt_wt_pooled", "chemberta_smiles_pooled" patterns.add(f"training_classifiers/binding_affinity/{folder}/best_model*") continue # infer emb_tag fallback if emb_tag is None: emb_tag = "wt" if parsed == row.best_wt else "smiles" suffix = EMB_TAG_TO_FOLDER_SUFFIX.get(emb_tag, emb_tag) # halflife special cases if prop_key == "halflife" and emb_tag == "wt": if model_name in {"transformer"}: for variant in ["transformer_wt_log", "transformer_wt"]: patterns.add(f"training_classifiers/{disk_prop}/{variant}/best_model*") continue if model_name in {"xgb", "xgb_reg"}: patterns.add(f"training_classifiers/{disk_prop}/xgb_wt_log/best_model*") continue patterns.add(f"training_classifiers/{disk_prop}/{model_name}_{suffix}/best_model*") patterns.add(f"training_classifiers/{disk_prop}/{model_name}/best_model*") return sorted(patterns) def fetch_models_and_data(): patterns = get_required_patterns(BEST_TXT) print(f"Downloading {len(patterns)} targeted pattern(s):") for p in patterns: print(f" {p}") snapshot_download( repo_id=MODEL_REPO, local_dir=str(ASSETS_MODELS), local_dir_use_symlinks=False, allow_patterns=patterns, ) """ def fetch_models_and_data(): snapshot_download( repo_id=MODEL_REPO, local_dir=str(ASSETS_MODELS), local_dir_use_symlinks=False, allow_patterns=[ # Model files "training_classifiers/**/best_model*.json", "training_classifiers/**/best_model*.pt", "training_classifiers/**/best_model*.joblib", # Tokenizer files "tokenizer/new_vocab.txt", "tokenizer/new_splits.txt", # Training data for distributions "training_data_cleaned/**/*.csv", ], ) """ fetch_models_and_data() # Property display names and descriptions PROPERTY_INFO = { 'solubility': { 'display': '๐Ÿ’ง Solubility', 'description': 'Aqueous solubility', 'direction': 'โ†‘', 'pass_label': 'Soluble', 'fail_label': 'Insoluble' }, 'permeability_penetrance': { 'display': '๐Ÿ”ฌ Permeability (Penetrance)', 'description': 'Cell penetration capability', 'direction': 'โ†‘', 'pass_label': 'Permeable', 'fail_label': 'Non-permeable' }, 'hemolysis': { 'display': '๐Ÿฉธ Hemolysis', 'description': 'Red blood cell membrane disruption', 'direction': 'โ†“', 'pass_label': 'Non-hemolytic', 'fail_label': 'Hemolytic' }, 'nf': { 'display': '๐Ÿ‘ฏ Non-Fouling', 'description': 'Resistance to protein adsorption', 'direction': 'โ†‘', 'pass_label': 'Non-fouling', 'fail_label': 'Fouling' }, 'halflife': { 'display': 'โฑ๏ธ Half-Life', 'description': 'Serum stability', 'direction': 'โ†‘', 'unit': 'hours' }, 'toxicity': { 'display': 'โ˜ ๏ธ Toxicity', 'description': 'Cytotoxicity', 'direction': 'โ†“', 'pass_label': 'Non-toxic', 'fail_label': 'Toxic' }, 'permeability_pampa': { 'display': '๐Ÿชฃ Permeability (PAMPA)', 'description': 'PAMPA assay permeability', 'direction': '', 'threshold': -6, # Values > -6 are permeable 'pass_label': 'Permeable', 'fail_label': 'Non-permeable' }, 'permeability_caco2': { 'display': '๐Ÿชฃ Permeability (Caco-2)', 'description': 'Caco-2 cell permeability', 'direction': '', 'threshold': -6, # Values > -6 are permeable 'pass_label': 'Permeable', 'fail_label': 'Non-permeable' }, 'binding_affinity': { 'display': '๐Ÿ”— Binding Affinity', 'description': 'Protein-peptide binding strength', 'direction': 'โ†‘', 'thresholds': {'tight': 9, 'weak': 7} } } PROP_ORDER = [ 'solubility', 'permeability_penetrance', 'hemolysis', 'nf', 'halflife', 'toxicity', 'permeability_pampa', 'permeability_caco2', 'binding_affinity', ] # Distribution-only keys DIST_KEYS = { "binding_affinity_wt": "๐Ÿ”— Binding Affinity โ€” WT (distribution)", "binding_affinity_smiles": "๐Ÿ”— Binding Affinity โ€” SMILES (distribution)", "binding_affinity_all": "๐Ÿ”— Binding Affinity โ€” WT+SMILES (distribution)", "halflife_wt": "โฑ๏ธ Half-life โ€” WT (distribution)", "halflife_smiles": "โฑ๏ธ Half-life โ€” SMILES (distribution)", "halflife_all": "โฑ๏ธ Half-life โ€” WT+SMILES (distribution)", } def create_filtered_manifest(manifest_path: Path) -> Dict[str, BestRow]: """Read manifest and replace banned models with XGB""" original = read_best_manifest_csv(manifest_path) filtered = {} for prop_key, row in original.items(): # Normalize property key for half-life normalized_key = prop_key if prop_key in ['halflife', 'half_life']: normalized_key = 'halflife' # Check and potentially replace WT model wt_model = canon_model(row.best_wt) if wt_model in BANNED_MODELS: wt_model = "XGB" elif wt_model is None: wt_model = row.best_wt else: wt_model = row.best_wt # Check and potentially replace SMILES model smiles_model = canon_model(row.best_smiles) if smiles_model in BANNED_MODELS: smiles_model = "XGB" elif smiles_model is None: smiles_model = row.best_smiles else: smiles_model = row.best_smiles # Create modified row filtered[normalized_key] = BestRow( property_key=normalized_key, best_wt=wt_model if wt_model != row.best_wt else row.best_wt, best_smiles=smiles_model if smiles_model != row.best_smiles else row.best_smiles, task_type=row.task_type, thr_wt=row.thr_wt, thr_smiles=row.thr_smiles, ) return filtered class AppContext: def __init__(self): self.device = torch.device("cuda" if torch.cuda.is_available() else "cpu") self.best = create_filtered_manifest(BEST_TXT) self.predictor = PeptiVersePredictor( manifest_path=BEST_TXT, classifier_weight_root=ASSETS_MODELS, esm_name="facebook/esm2_t33_650M_UR50D", clm_name="aaronfeller/PeptideCLM-23M-all", smiles_vocab=str(Path(__file__).parent / "tokenizer" / "new_vocab.txt"), smiles_splits=str(Path(__file__).parent / "tokenizer" / "new_splits.txt"), device=str(self.device), ) # override manifest AND reload models so keys/folders match self.predictor.manifest = self.best self.predictor.models.clear() self.predictor.meta.clear() self.predictor._load_all_best_models() CTX: AppContext | None = None def initialize(): global CTX if CTX is None: CTX = AppContext() return CTX def get_available_properties(ctx, modality: str) -> Dict[str, bool]: """ Returns dict of property -> bool indicating if available for the modality """ available = {} for prop_key in PROPERTY_INFO.keys(): if prop_key not in ctx.best: available[prop_key] = False continue row = ctx.best[prop_key] if modality == "Sequence": model = row.best_wt else: model = row.best_smiles # Check if model exists and is not empty/dash if not model or model in {"-", "โ€”", "NA", "N/A", None}: available[prop_key] = False else: # Check if we actually have the model loaded mode = "wt" if modality == "Sequence" else "smiles" available[prop_key] = (prop_key, mode) in ctx.predictor.models return available def get_threshold(ctx: AppContext, prop: str, modality: str) -> float | None: row = ctx.best.get(prop) if row is None: return None return row.thr_wt if modality == "Sequence" else row.thr_smiles def get_best_models_table(ctx: AppContext) -> pd.DataFrame: """Generate a table showing best models and thresholds""" data = [] for prop_key, row in ctx.best.items(): prop_info = PROPERTY_INFO.get(prop_key, {}) display_name = prop_info.get('display', prop_key) data.append({ 'Property': display_name, 'Best Model (Sequence)': row.best_wt if row.best_wt else 'โ€”', 'Threshold (Sequence)': f"{row.thr_wt:.4f}" if row.thr_wt is not None else 'โ€”', 'Best Model (SMILES)': row.best_smiles if row.best_smiles else 'โ€”', 'Threshold (SMILES)': f"{row.thr_smiles:.4f}" if row.thr_smiles is not None else 'โ€”', 'Task Type': row.task_type }) return pd.DataFrame(data) try: from rdkit import Chem from rdkit.Chem import Descriptors, AllChem RDKIT_AVAILABLE = True except ImportError: RDKIT_AVAILABLE = False print("RDKit not available. SMILES input will be disabled.") import re AA_RE = re.compile(r'^[ACDEFGHIKLMNPQRSTVWYBXZJUO\-]+$', re.IGNORECASE) def is_aa_sequence_like(s: str) -> bool: s = s.strip().replace(" ", "") if not s: return False # Very lenient: allow AA letters + optional '-' for readability return bool(AA_RE.fullmatch(s)) and any(c.isalpha() for c in s) def is_smiles_like(s: str) -> bool: s = s.strip() if not s: return False # Heuristic: SMILES often contains these symbols; also reject if it looks like pure AA maybe_smiles_chars = set("=#()[]+\\/-@1234567890") return (any(ch in maybe_smiles_chars for ch in s) or not is_aa_sequence_like(s)) and len(s) >= 2 # ==================== Sequence Analysis ==================== class SequenceAnalyzer: """Calculate physicochemical properties of peptide sequences If biopython fail. """ # pKa values for amino acids PKA_VALUES = { 'N_term': 9.6, 'C_term': 2.3, 'D': 3.9, # Aspartic acid 'E': 4.2, # Glutamic acid 'H': 6.0, # Histidine 'C': 8.3, # Cysteine 'Y': 10.1, # Tyrosine 'K': 10.5, # Lysine 'R': 12.5, # Arginine } @classmethod def calculate_net_charge(cls, sequence: str, pH: float = 7.0) -> float: """Calculate net charge at given pH using Henderson-Hasselbalch equation""" if BIOPYTHON_AVAILABLE: try: analyzer = ProteinAnalysis(sequence) return analyzer.charge_at_pH(pH) except: pass # Fallback calculation charge = 0 # N-terminus charge += 1 / (1 + 10**(pH - cls.PKA_VALUES['N_term'])) # C-terminus charge -= 1 / (1 + 10**(cls.PKA_VALUES['C_term'] - pH)) # Count charged residues for aa in sequence: if aa in 'KR': # Positive pKa = cls.PKA_VALUES.get(aa, cls.PKA_VALUES['K' if aa == 'K' else 'R']) charge += 1 / (1 + 10**(pH - pKa)) elif aa in 'DE': # Negative pKa = cls.PKA_VALUES.get(aa, cls.PKA_VALUES['D' if aa == 'D' else 'E']) charge -= 1 / (1 + 10**(pKa - pH)) elif aa == 'H': # Histidine (positive when protonated) charge += 1 / (1 + 10**(pH - cls.PKA_VALUES['H'])) elif aa == 'C': # Cysteine (negative when deprotonated) charge -= 1 / (1 + 10**(cls.PKA_VALUES['C'] - pH)) elif aa == 'Y': # Tyrosine (negative when deprotonated) charge -= 1 / (1 + 10**(cls.PKA_VALUES['Y'] - pH)) return round(charge, 2) @classmethod def calculate_isoelectric_point(cls, sequence: str) -> float: """Calculate theoretical pI using bisection method""" if BIOPYTHON_AVAILABLE: try: analyzer = ProteinAnalysis(sequence) return analyzer.isoelectric_point() except: pass # Fallback: Bisection method pH_min, pH_max = 0.0, 14.0 epsilon = 0.01 while (pH_max - pH_min) > epsilon: pH_mid = (pH_min + pH_max) / 2 charge = cls.calculate_net_charge(sequence, pH_mid) if abs(charge) < epsilon: return round(pH_mid, 2) if charge > 0: pH_min = pH_mid else: pH_max = pH_mid return round((pH_min + pH_max) / 2, 2) @classmethod def calculate_molecular_weight(cls, sequence: str) -> float: """Calculate molecular weight""" if BIOPYTHON_AVAILABLE: try: analyzer = ProteinAnalysis(sequence) return analyzer.molecular_weight() except: pass # Fallback: approximate calculation weights = { 'A': 89.1, 'C': 121.2, 'D': 133.1, 'E': 147.1, 'F': 165.2, 'G': 75.1, 'H': 155.2, 'I': 131.2, 'K': 146.2, 'L': 131.2, 'M': 149.2, 'N': 132.1, 'P': 115.1, 'Q': 146.2, 'R': 174.2, 'S': 105.1, 'T': 119.1, 'V': 117.1, 'W': 204.2, 'Y': 181.2 } mw = sum(weights.get(aa, 0) for aa in sequence) # Subtract water for peptide bonds mw -= 18.0 * (len(sequence) - 1) return round(mw, 1) @classmethod def calculate_hydrophobicity(cls, sequence: str) -> float: """Calculate GRAVY (grand average of hydropathy)""" if BIOPYTHON_AVAILABLE: try: analyzer = ProteinAnalysis(sequence) return analyzer.gravy() except: pass # Kyte-Doolittle scale hydrophobicity = { 'A': 1.8, 'C': 2.5, 'D': -3.5, 'E': -3.5, 'F': 2.8, 'G': -0.4, 'H': -3.2, 'I': 4.5, 'K': -3.9, 'L': 3.8, 'M': 1.9, 'N': -3.5, 'P': -1.6, 'Q': -3.5, 'R': -4.5, 'S': -0.8, 'T': -0.7, 'V': 4.2, 'W': -0.9, 'Y': -1.3 } if len(sequence) == 0: return 0 total = sum(hydrophobicity.get(aa, 0) for aa in sequence) return round(total / len(sequence), 2) # ==================== Data Management ==================== class TrainingDataManager: def __init__(self, data_dir=None): possible_dirs = [ ASSETS_MODELS / "training_data_cleaned", # In HF downloaded location Path("training_data_cleaned"), # Local relative path ASSETS_DATA, # Original location ] self.data_dir = None for d in possible_dirs: if d.exists(): self.data_dir = d print(f"Using data directory: {d}") break if self.data_dir is None: print(f"WARNING: No data directory found. Tried: {possible_dirs}") self.data_dir = ASSETS_DATA # Fallback self.data_dir.mkdir(exist_ok=True) self.statistics = self.load_statistics() def load_csv_data(self, filepath: Path, value_column, is_binary: bool = False) -> Optional[Dict]: """Load data from a CSV file. value_column can be a string OR a list/tuple of candidate column names. """ if not filepath.exists(): print(f"File not found: {filepath}") return None try: df = pd.read_csv(filepath, encoding="utf-8", on_bad_lines="skip") print(f"Columns in {filepath.name}: {df.columns.tolist()[:5]}...") # Case-insensitive column map col_lower = {col.lower(): col for col in df.columns} # allow list/tuple of candidates if isinstance(value_column, (list, tuple)): chosen = None for c in value_column: if c is None: continue c_l = str(c).lower() if c_l in col_lower: chosen = col_lower[c_l] break if chosen is None: print(f"None of candidate columns {value_column} found. Available: {list(df.columns)[:10]}") return None value_column = chosen else: # keep original behavior, but safe-cast to str vc_l = str(value_column).lower() if vc_l not in col_lower: alternatives = { 'label': ['label', 'labels', 'y', 'target'], 'affinity': ['affinity', 'pkd', 'pki', 'binding_affinity'], 'pampa': ['pampa', 'pampa_value', 'permeability'], 'caco2': ['caco2', 'caco-2', 'caco_2'], 'log_hour': ['log_hour', 'loghour', 'log_hours', 'loghours'], 'half_life_hours': ['half_life_hours', 'halflife_hours', 'hours'], 'half_life_seconds': ['half_life_seconds', 'halflife_seconds', 'seconds'], } found = False for alt in alternatives.get(vc_l, []): if alt.lower() in col_lower: value_column = col_lower[alt.lower()] found = True break if not found: print(f"Column {value_column} not found. Available: {list(df.columns)[:10]}") return None else: value_column = col_lower[vc_l] vals = pd.to_numeric(df[value_column], errors="coerce").dropna().to_numpy() if len(vals) == 0: print(f"No valid values found in column {value_column}") return None print(f"Loaded {len(vals)} values from {filepath.name}") if is_binary: unique_vals = np.unique(vals) if not set(unique_vals).issubset({0, 1, 0.0, 1.0}): vals = (vals > 0.5).astype(int) return {"values": vals, "n_samples": len(vals)} except Exception as e: print(f"Error loading {filepath}: {e}") import traceback traceback.print_exc() return None def load_statistics(self): """Load pre-computed statistics for each property from actual data files""" stats = {} # Map properties to their data files and value columns data_mappings = { 'hemolysis': { 'files': [ 'hemolysis/hemo_meta_with_split.csv', 'hemolysis/hemolysis_meta_with_split.csv', ], 'column': 'label', 'is_binary': True }, 'solubility': { 'files': [ 'solubility/sol_meta_with_split.csv', 'solubility/solubility_meta_with_split.csv', ], 'column': 'label', 'is_binary': True }, "binding_affinity_wt": { "files": ["binding_affinity/binding_affinity_wt_meta_with_split.csv"], "column": "affinity", "is_binary": False }, "binding_affinity_smiles": { "files": ["binding_affinity/binding_affinity_smiles_meta_with_split.csv"], "column": "affinity", "is_binary": False }, "binding_affinity_all": { "files": [ "binding_affinity/binding_affinity_wt_meta_with_split.csv", "binding_affinity/binding_affinity_smiles_meta_with_split.csv", ], "column": "affinity", "is_binary": False }, "halflife_wt": { "files": [ "half_life/halflife_with_split.csv", "half_life/halflife_meta_with_split.csv", ], "column": ["half_life_hours", "log_hour", "log_hours"], "is_binary": False }, "halflife_smiles": { "files": [ "half_life/halflife_smiles_with_split.csv", "half_life/halflife_smiles_with_splits.csv", "half_life/halflife_smiles_meta_with_split.csv", ], "column": ["half_life_hours", "log_hour", "log_hours"], "is_binary": False }, "halflife_all": { "files": [ "half_life/halflife_with_split.csv", "half_life/halflife_meta_with_split.csv", "half_life/halflife_smiles_with_split.csv", "half_life/halflife_smiles_with_splits.csv", "half_life/halflife_smiles_meta_with_split.csv", ], "column": ["half_life_hours", "log_hour", "log_hours"], "is_binary": False }, 'nf': { 'files': [ 'nonfouling/nf_meta_with_split.csv', 'nf/nf_meta_with_split.csv', ], 'column': 'label', 'is_binary': True }, 'permeability_penetrance': { 'files': [ 'permeability/perm_meta_with_split.csv', 'permeability_penetrance/permeability_meta_with_split.csv', ], 'column': 'label', 'is_binary': True }, 'permeability_pampa': { 'files': [ 'permeability_pampa/pampa_meta_with_split.csv', 'pampa/pampa_meta_with_split.csv', ], 'column': 'PAMPA', 'is_binary': False }, 'permeability_caco2': { 'files': [ 'permeability_caco2/caco2_meta_with_split.csv', 'caco2/caco2_meta_with_split.csv', ], 'column': 'Caco2', 'is_binary': False }, 'toxicity': { 'files': [ 'toxicity/tox_meta_with_split.csv', 'toxicity/toxicity_meta_with_split.csv', ], 'column': 'label', 'is_binary': True } } # Load actual data for prop_key, mapping in data_mappings.items(): all_vals = [] loaded_from = [] for file_path in mapping['files']: filepath = self.data_dir / file_path if not filepath.exists(): continue d = self.load_csv_data( filepath, mapping['column'], mapping.get('is_binary', False) ) if d: all_vals.append(d["values"]) loaded_from.append(file_path) if all_vals: vals = np.concatenate(all_vals, axis=0) prop_info = PROPERTY_INFO.get(prop_key, {}) stats[prop_key] = { "values": vals, "description": prop_info.get("description", ""), "unit": "Probability" if mapping.get("is_binary") else prop_info.get("unit", "Score"), "n_samples": int(vals.shape[0]), "kind": "binary" if mapping.get("is_binary") else "continuous", "loaded_from": loaded_from, # optional: good for debugging } # thresholds / unit tweaks if prop_key == "binding_affinity": stats[prop_key]["threshold"] = 9 stats[prop_key]["threshold_secondary"] = 7 stats[prop_key]["unit"] = "pKd/pKi" elif prop_key in ["permeability_pampa", "permeability_caco2"]: stats[prop_key]["threshold"] = -6 stats[prop_key]["unit"] = "log Peff" if prop_key == "permeability_pampa" else "log Papp" elif prop_key == "halflife": stats[prop_key]["unit"] = "hours" # for distribution plotting if prop_key.startswith("binding_affinity"): stats[prop_key]["threshold"] = 9 stats[prop_key]["threshold_secondary"] = 7 stats[prop_key]["unit"] = "pKd/pKi" elif prop_key.startswith("halflife"): stats[prop_key]["unit"] = "hours" print(f"โœ“ Loaded {prop_key} from {loaded_from} ({len(vals)} samples)") continue # fallback synthetic print(f"โš  Using synthetic data for {prop_key}") return stats def get_distribution_plot(self, property_name, current_value=None): if property_name not in self.statistics: return None s = self.statistics[property_name] vals = np.asarray(s["values"]) kind = s.get("kind", "continuous") if kind == "binary": n0 = int((vals == 0).sum()) n1 = int((vals == 1).sum()) total = max(n0 + n1, 1) fig = go.Figure() prop_info = PROPERTY_INFO.get(property_name, {}) labels = [ prop_info.get('fail_label', 'Negative (0)'), prop_info.get('pass_label', 'Positive (1)') ] fig.add_trace(go.Bar(x=labels, y=[n0, n1])) fig.update_layout( title=f"{prop_info.get('display', property_name)} โ€” Class Distribution", xaxis_title="Class", yaxis_title="Count", height=400, showlegend=False, annotations=[ dict(x=labels[0], y=n0, text=f"{n0} ({n0/total:.1%})", showarrow=False, yshift=8), dict(x=labels[1], y=n1, text=f"{n1} ({n1/total:.1%})", showarrow=False, yshift=8), ], ) return fig # Continuous distribution fig = go.Figure() fig.add_trace(go.Histogram(x=vals, nbinsx=50, name="Training Data")) # Primary threshold (if any) if "threshold" in s and s["threshold"] is not None: fig.add_vline( x=float(s["threshold"]), line_dash="dash", line_color="purple" if property_name == "binding_affinity" else "red", annotation_text=( "Tight threshold: {:.3f}".format(float(s["threshold"])) if property_name == "binding_affinity" else "Threshold: {:.3f}".format(float(s["threshold"])) ), ) # Secondary threshold for binding (weak) if property_name == "binding_affinity" and "threshold_secondary" in s and s["threshold_secondary"] is not None: fig.add_vline( x=float(s["threshold_secondary"]), line_dash="dash", line_color="orange", annotation_text="Weak threshold: {:.3f}".format(float(s["threshold_secondary"])), ) # Current value if current_value is not None: fig.add_vline( x=float(current_value), line_dash="solid", line_color="green", line_width=3, annotation_text=f"Your Result: {float(current_value):.3f}", ) prop_info = PROPERTY_INFO.get(property_name, {}) fig.update_layout( title=f"{prop_info.get('display', property_name)} Distribution", xaxis_title=s.get("unit", ""), yaxis_title="Count", height=400, showlegend=False, ) return fig def get_property_info(self, property_name): if property_name not in self.statistics: return None s = self.statistics[property_name] vals = np.asarray(s["values"]) kind = s.get("kind", "continuous") info = { "description": s.get("description", ""), "unit": s.get("unit", ""), "n_samples": int(len(vals)), "mean": float(np.mean(vals)), "std": float(np.std(vals)), "min": float(np.min(vals)), "max": float(np.max(vals)), "percentiles": {}, } if kind == "binary": info["n_neg"] = int((vals == 0).sum()) info["n_pos"] = int((vals == 1).sum()) else: pct = np.percentile(vals, [10, 25, 50, 75, 90]) info["percentiles"] = { "10%": float(pct[0]), "25%": float(pct[1]), "50% (median)": float(pct[2]), "75%": float(pct[3]), "90%": float(pct[4]), } return info # ==================== Gradio Interface ==================== def predict_properties( input_text: str, input_type: str, # "Sequence" or "SMILES" protein_text: str, # For binding affinity selected_props: list[str], # from individual checkboxes include_physicochemical: bool, pH_value: float, progress=gr.Progress() ): if not input_text or not input_text.strip(): return None, "โš ๏ธ Please provide input." lines = [s.strip() for s in input_text.split("\n") if s.strip()] if input_type == "Sequence": bad = [s for s in lines if not is_aa_sequence_like(s)] if bad: return None, f"โš ๏ธ Input Type=Sequence but {len(bad)} line(s) don't look like AA sequences. Example: {bad[0][:60]}" else: bad = [s for s in lines if not is_smiles_like(s)] if bad: return None, f"โš ๏ธ Input Type=SMILES but {len(bad)} line(s) don't look like SMILES. Example: {bad[0][:60]}" ctx = initialize() print("keys in ctx.best:", sorted(ctx.best.keys())) print("loaded model keys:", sorted(ctx.predictor.models.keys())) print("halflife wt loaded?", ("halflife","wt") in ctx.predictor.models) print("halflife smiles loaded?", ("halflife","smiles") in ctx.predictor.models) if not selected_props: return None, "โš ๏ธ Please select at least one property." results = [] analyzer = SequenceAnalyzer() # Check availability available = get_available_properties(ctx, input_type) unavailable = [p for p in selected_props if not available.get(p, False)] if unavailable: unavailable_names = [PROPERTY_INFO.get(p, {}).get('display', p) for p in unavailable] return None, f"โš ๏ธ These properties are not supported for {input_type}: {', '.join(unavailable_names)}" for i, s in enumerate(lines): progress((i + 1) / len(lines), f"Processing {i+1}/{len(lines)}") # Regular property predictions for prop in selected_props: if prop == "binding_affinity": # Handle binding affinity separately if not protein_text or not protein_text.strip(): results.append({ "Input": s[:30] + "..." if len(s) > 30 else s, "Property": PROPERTY_INFO[prop]['display'], "Prediction": "N/A", "Value": "Requires protein", "Unit": "", }) continue mode = "wt" if input_type == "Sequence" else "smiles" try: result = ctx.predictor.predict_binding_affinity(mode, protein_text.strip(), s) affinity = result["affinity"] # Determine binding class based on thresholds if affinity >= 9: class_label = "Tight binding" elif affinity >= 7: class_label = "Medium binding" else: class_label = "Weak binding" results.append({ "Input": s[:30] + "..." if len(s) > 30 else s, "Property": PROPERTY_INFO[prop]['display'], "Prediction": class_label, "Value": f"{affinity:.3f}", "Unit": "pKd/pKi", }) except Exception as e: print(f"Error predicting binding affinity: {e}") results.append({ "Input": s[:30] + "..." if len(s) > 30 else s, "Property": PROPERTY_INFO[prop]['display'], "Prediction": "Error", "Value": "Failed", "Unit": "", }) continue # Regular properties mode = "wt" if input_type == "Sequence" else "smiles" try: result = ctx.predictor.predict_property(prop, mode, s) score = result["score"] prop_info = PROPERTY_INFO.get(prop, {}) # Determine label based on property type if prop in ['permeability_pampa', 'permeability_caco2']: # Special handling for permeability assays label = prop_info['pass_label'] if score > -6 else prop_info['fail_label'] unit = "log Peff" if prop == 'permeability_pampa' else "log Papp" elif prop == 'halflife': # Regression task, no pass/fail label = "โ€”" unit = prop_info.get('unit', 'hours') else: # Classification tasks thr = get_threshold(ctx, prop, input_type) if thr is not None: if prop in LOWER_BETTER: label = prop_info.get('pass_label', 'Pass') if score < thr else prop_info.get('fail_label', 'Fail') else: label = prop_info.get('pass_label', 'Pass') if score >= thr else prop_info.get('fail_label', 'Fail') else: label = "โ€”" unit = "Probability" results.append({ "Input": s[:30] + "..." if len(s) > 30 else s, "Property": prop_info.get('display', prop), "Prediction": label, "Value": f"{score:.3f}", "Unit": unit, }) except Exception as e: print(f"Error predicting {prop} for {s[:30]}: {e}") continue # physicochemical only for AA sequence modality if input_type == "Sequence" and include_physicochemical: analysis = { "length": len(s), "molecular_weight": analyzer.calculate_molecular_weight(s), "net_charge": analyzer.calculate_net_charge(s, pH_value), "isoelectric_point": analyzer.calculate_isoelectric_point(s), "hydrophobicity": analyzer.calculate_hydrophobicity(s), } short = s[:30] + "..." if len(s) > 30 else s results += [ {"Input": short, "Property": "๐Ÿ“ Length", "Prediction": "", "Value": str(analysis["length"]), "Unit": "aa"}, {"Input": short, "Property": "โš–๏ธ Molecular Weight", "Prediction": "", "Value": f"{analysis['molecular_weight']:.1f}", "Unit": "Da"}, {"Input": short, "Property": f"โšก Net Charge (pH {pH_value})", "Prediction": "", "Value": f"{analysis['net_charge']:.2f}", "Unit": ""}, {"Input": short, "Property": "๐ŸŽฏ Isoelectric Point", "Prediction": "", "Value": f"{analysis['isoelectric_point']:.2f}", "Unit": "pH"}, {"Input": short, "Property": "๐Ÿ’ฆ Hydrophobicity (GRAVY)", "Prediction": "", "Value": f"{analysis['hydrophobicity']:.2f}", "Unit": "GRAVY"}, ] df = pd.DataFrame(results) status = f"โœ… Completed {len(df)} rows ({len(lines)} input(s), {len(selected_props)} selected properties)." return df, status def show_distribution(property_name, predicted_value=None): """Show distribution plot + info for selected property.""" data_manager = TrainingDataManager() if not property_name: return None, "Select a property to view its distribution." # Get the first property if a list was passed prop = property_name[0] if isinstance(property_name, list) else property_name # Generate the plot fig = data_manager.get_distribution_plot(prop, predicted_value) # Build info panel info = data_manager.get_property_info(prop) if not info: return fig, "No information available for this property." prop_info = PROPERTY_INFO.get(prop, {}) title = DIST_KEYS.get(prop, PROPERTY_INFO.get(prop, {}).get("display", prop)) kind = data_manager.statistics.get(prop, {}).get("kind", "continuous") if kind == "binary": n_pos = info.get("n_pos", 0) n_neg = info.get("n_neg", 0) total = max(n_pos + n_neg, 1) info_text = f""" #### {title} Information **Description:** {info.get('description','')} **Statistics (Binary):** - Samples: {info['n_samples']:,} - {prop_info.get('pass_label', 'Positive')} (1): {n_pos:,} ({n_pos/total:.1%}) - {prop_info.get('fail_label', 'Negative')} (0): {n_neg:,} ({n_neg/total:.1%}) """ else: p = info.get("percentiles", {}) info_text = f""" #### {title} Information **Description:** {info.get('description','')} **Statistics:** - Samples: {info['n_samples']:,} - Mean: {info['mean']:.3f} {info['unit']} - Std Dev: {info['std']:.3f} - Range: [{info['min']:.3f}, {info['max']:.3f}] **Percentiles:** - 10%: {p.get('10%', float('nan')):.3f} - 25%: {p.get('25%', float('nan')):.3f} - 50% (median): {p.get('50% (median)', float('nan')):.3f} - 75%: {p.get('75%', float('nan')):.3f} - 90%: {p.get('90%', float('nan')):.3f} """ return fig, info_text def load_example(example_name): """Load example sequences""" examples = { "T7 Peptide": ("HAIYPRH", ""), "Protein-Peptide": ( "GIVEQCCTSICSLYQLENYCN", "MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST" ), "Cyclic Peptide (SMILES)": ( "CC(C)C[C@@H]1NC(=O)[C@@H](CC(C)C)N(C)C(=O)[C@@H](C)N(C)C(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H]2CCCN2C1=O", "" ), "Protein-Cyclic Peptide (SMILES)": ( "CC(C)C[C@@H]1NC(=O)[C@@H](CC(C)C)N(C)C(=O)[C@@H](C)N(C)C(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H]2CCCN2C1=O", "MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST" ), "None": ("", ""), } return examples.get(example_name, ("", "")) def on_example_change(name: str): if not name: return gr.update(), gr.update() binder, protein = load_example(name) show_protein = name in ["Protein-Peptide", "Protein-Cyclic Peptide (SMILES)"] return ( gr.update(value=binder), gr.update(value=protein, visible=show_protein), ) def on_modality_change(modality, *checkbox_values): ctx = initialize() available = get_available_properties(ctx, modality) updates = [] for i, prop_key in enumerate(PROP_ORDER): is_available = available.get(prop_key, False) prop_info = PROPERTY_INFO[prop_key] label_text = f"{prop_info['display']} {prop_info.get('direction','')}".rstrip() if not is_available: label_text += " (Not supported)" if prop_key == "binding_affinity" and is_available: label_text += " *" current_value = checkbox_values[i] if i < len(checkbox_values) else False updates.append(gr.update( label=label_text, interactive=is_available, value=False if not is_available else current_value )) return updates def collect_selected_properties(*checkbox_values): selected = [] for i, prop_key in enumerate(PROP_ORDER): if i < len(checkbox_values) and checkbox_values[i]: selected.append(prop_key) return selected # ==================== Gradio App ==================== def load_custom_css(): """Load CSS styling document""" css_file = "peptiverse_styles.css" try: with open(css_file, 'r', encoding='utf-8') as f: return f.read() except FileNotFoundError: print(f"Warning: CSS file '{css_file}' not found. Using default styles.") # Minimal fallback CSS return """ .gradio-container { font-family: 'Inter', -apple-system, BlinkMacSystemFont, 'Segoe UI', Roboto, sans-serif; font-size: 16px !important; } """ except Exception as e: print(f"Error loading CSS: {e}") return "" custom_css = load_custom_css() def get_title_html(): """Load light/dark SVG title and swap via prefers-color-scheme""" import base64, os def load_svg_b64(path): if not os.path.exists(path): return None with open(path, "rb") as f: return base64.b64encode(f.read()).decode("utf-8") light_b64 = load_svg_b64("peptiverse-light-withlogo.svg") dark_b64 = load_svg_b64("peptiverse-dark-withlogo.svg") if light_b64 or dark_b64: imgs = [] if light_b64: imgs.append(f''' ''') if dark_b64: imgs.append(f''' ''') return f'''
{''.join(imgs)}
''' # ---------- Fallback ---------- return '''
๐ŸŒ PeptiVerse
''' with gr.Blocks(css=custom_css, theme=gr.themes.Soft(primary_hue="indigo")) as demo: ctx = initialize() # Header with SVG title support title_html = get_title_html() gr.HTML(title_html) gr.Markdown( """ # ๐ŸŒ PeptiVerse """, visible=False ) with gr.Tabs(): # Main Prediction Tab with gr.TabItem("๐Ÿ”ฌ Predict", elem_classes="predict-tab"): with gr.Row(): # Input Section with gr.Column(scale=1): with gr.Group(): gr.Markdown("### ๐Ÿ“ Input") input_type = gr.Radio( ["Sequence", "SMILES"], label="Input Type", value="Sequence" ) # Load T7 peptide by default input_text = gr.Textbox( label="Peptide Sequence(s) / SMILES", placeholder="Enter amino acid sequence(s) or SMILES, one per line", lines=6, value="HAIYPRH" ) protein_seq = gr.Textbox( label="Protein Sequence (for binding prediction)", placeholder="Enter target protein sequence", lines=3, visible=False ) gr.Markdown("**Examples:**") example_dropdown = gr.Dropdown( choices=["None", "T7 Peptide", "Protein-Peptide", "Cyclic Peptide (SMILES)", "Protein-Cyclic Peptide (SMILES)"], label="Load Example", value="T7 Peptide", # Set T7 as default interactive=True, allow_custom_value=False ) # Property Selection with gr.Column(scale=1): with gr.Group(): gr.Markdown("### โš™๏ธ Select Properties") with gr.Accordion("Physicochemical Properties", open=True, elem_id="acc_phys"): include_physicochemical = gr.Checkbox( label="๐Ÿงช Calculate Basic Properties", value=True, info="MW, net charge, pI, hydrophobicity (Sequence only)" ) pH_value = gr.Slider( minimum=0, maximum=14, value=7.0, step=0.1, label="pH for Net Charge", info="Physiological pH is ~7.4" ) # Create individual checkboxes in fixed order with gr.Accordion("Prediction Properties", open=True, elem_id="acc_pred"): property_checkboxes = [] available = get_available_properties(ctx, "Sequence") for prop_key in PROP_ORDER: prop_info = PROPERTY_INFO[prop_key] is_available = available.get(prop_key, False) label_text = f"{prop_info['display']} {prop_info.get('direction','')}".rstrip() if not is_available: label_text += " (Not supported)" if prop_key == "binding_affinity" and is_available: label_text += " *" default_on = (prop_key in ["solubility", "hemolysis"]) # optional defaults cb = gr.Checkbox( label=label_text, value=is_available and default_on, interactive=is_available, elem_id=f"checkbox_{prop_key}", ) property_checkboxes.append(cb) gr.Markdown("*Requires protein sequence input above", elem_classes="text-sm text-gray-500") # Best Models Tab with gr.TabItem("๐Ÿ“‹ Best Models", elem_classes="best-models-tab"): gr.Markdown("### Current Best Models Configuration") gr.Markdown("This table shows the models and thresholds currently being used for predictions:") best_models_df = gr.Dataframe( value=get_best_models_table(ctx), headers=["Property", "Best Model (Sequence)", "Threshold (Sequence)", "Best Model (SMILES)", "Threshold (SMILES)", "Task Type"], interactive=False, elem_id="best_models_df" ) gr.Markdown(""" **Note:** Models marked as SVM, SVR, or ENET are automatically replaced with XGB as these models are not currently supported in the deployment environment. """) # Distribution Analysis Tab with gr.TabItem("๐Ÿ“Š Distributions", elem_classes="distributions-tab"): with gr.Row(): with gr.Column(scale=1): base_props = [ k for k in PROPERTY_INFO.keys() if k not in {"halflife", "binding_affinity"} ] dist_choices = base_props + list(DIST_KEYS.keys()) property_selector = gr.Dropdown( choices=dist_choices, label="Select Property", value="binding_affinity_all" ) test_value = gr.Number(label="Test Value among Distribution", value=None) show_dist_btn = gr.Button("Show Distribution") with gr.Column(scale=2): dist_plot_tab = gr.Plot(label="Score Distribution") dist_info_tab = gr.Markdown() # Data Documentation Tab with gr.TabItem("๐Ÿ“š Documentation", elem_classes="documentation-tab"): # Load documentation doc_file_path = "description.md" try: with open(doc_file_path, "r", encoding="utf-8") as f: markdown_content = f.read() except FileNotFoundError: print(f"Warning: Documentation file '{doc_file_path}' not found.") markdown_content = """ # Documentation Documentation file not found. Please ensure `description.md` is in the same directory as the app. """ except Exception as e: print(f"Error loading documentation: {e}") markdown_content = "# Error loading documentation" gr.Markdown(markdown_content) # Action Buttons with gr.Row(): clear_btn = gr.Button("๐Ÿ—‘๏ธ Clear", variant="secondary") predict_btn = gr.Button("๐Ÿš€ Predict Properties", variant="primary", scale=2) # Status status_output = gr.Markdown("") # Results Section with gr.Group(): gr.Markdown("### ๐Ÿ“Š Results") results_df = gr.Dataframe( headers=["Input", "Property", "Prediction", "Value", "Unit"], datatype=["str", "str", "str", "str", "str"], interactive=False, elem_id="results_df" ) # Footer gr.Markdown( """ ---

PeptiVerse - A Unified Platform for peptide therapeutic property prediction.

Please cite our work if you use this tool in your research.

""" ) # Event Handlers def update_visibility(binding_checked): return gr.update(visible=binding_checked) # Update checkbox states when modality changes input_type.change( on_modality_change, inputs=[input_type] + property_checkboxes, outputs=property_checkboxes ) # Show protein sequence input when binding affinity is selected BINDING_IDX = PROP_ORDER.index("binding_affinity") property_checkboxes[BINDING_IDX].change( update_visibility, inputs=[property_checkboxes[BINDING_IDX]], outputs=[protein_seq], ) example_dropdown.change( on_example_change, inputs=[example_dropdown], outputs=[input_text, protein_seq] ) predict_btn.click( lambda input_text, input_type, protein_text, include_physicochemical, pH_value, *checkbox_values: predict_properties( input_text, input_type, protein_text, collect_selected_properties(*checkbox_values), include_physicochemical, pH_value ), inputs=[input_text, input_type, protein_seq, include_physicochemical, pH_value] + property_checkboxes, outputs=[results_df, status_output] ) clear_btn.click( lambda: ["", "", "None", None, ""] + [False] * len(property_checkboxes), outputs=[input_text, protein_seq, example_dropdown, results_df, status_output] + property_checkboxes ) show_dist_btn.click( show_distribution, inputs=[property_selector, test_value], outputs=[dist_plot_tab, dist_info_tab] ) if __name__ == "__main__": print("Initializing models...") initialize() print("Ready!") demo.launch(share=True)